current location： Index » Ⅰ.Amino Acids,Protected Amino Acids &Peptide Synthesis » 2.Peptides » 2.2. Peptides » 2.2.1. Pharmaceutical Peptides(For Research Only) 
All Categories
Hot Sales
- 1
5-bromo-2-vinylpyridine ￥3019.00 - 2
GLP-2 (1-33) (human)... ￥1584.00 - 3
(Des-Thr⁷)-Glucagon... ￥1344.00 - 4
3,5-difluoro-Tyrosine ￥300.00 - 5
Alytesin ￥480.00 - 6
Boc-Gly-Gly-Leu-pNA ￥1040.00 - 7
Boc-Gly-Lys-Arg-AMC · HCl ￥1040.00 - 8
L-Phenylalanine... ￥57.00 - 9
N-2-Chloroethyl-Val-Le... ￥4886.00 - 10
4-Methyl-3-thienylboro... ￥1346.00
A total of 27 goods were found
 | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2Number:3P17 CAS: 196078-30-5 |
|
 | H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH297%Number:3P19 CAS: 17034-35-4 |
|
 | VLACDKKFDNEGREASCSKAIREKYKPFYVAPPPVNumber:3P21 |
|
| | YGYDGKPLADSFCKGAGSNumber:3P18 |
|
 | ω-Conotoxin MVIIAH-Cys-Lys-Gly-Lys-Gly-Ala-Lys-Cys-Ser-Arg-Leu-Met-Tyr-Asp-Cys-Cys-Thr-Gly-Ser-Cys-Arg-Ser-Gly-Lys-Cys-NH₂ (Disulfide bonds between Cys¹ and Cys¹⁶/Cys⁸ and Cys²⁰/Cys¹⁵ and Cys²⁵) HPLC纯度: >95%Number:3P23 CAS: 107452-89-1 |
|
 | Mpr-Harg-Gly-Asp-Trp-Pro-Cys-NH2,( Disulfide Bridg on Mpr and Cys)Number:3P29 CAS: 148031-34-9 |
|
